Lineage for d7ue0a_ (7ue0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809519Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2809520Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)
  6. 2809521Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 2809522Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (27 PDB entries)
    Uniprot P08514 32-483
  8. 3086877Domain d7ue0a_: 7ue0 A: [423194]
    Other proteins in same PDB: d7ue0e_, d7ue0f_, d7ue0h_, d7ue0l_
    automated match to d3niga_
    complexed with ca, cl, gol, mg, mwx, nag, so4

Details for d7ue0a_

PDB Entry: 7ue0 (more details), 2.74 Å

PDB Description: integrin alaphiibbeta3 complex with fradafiban
PDB Compounds: (A:) Integrin alpha-IIb heavy chain

SCOPe Domain Sequences for d7ue0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ue0a_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqpvv

SCOPe Domain Coordinates for d7ue0a_:

Click to download the PDB-style file with coordinates for d7ue0a_.
(The format of our PDB-style files is described here.)

Timeline for d7ue0a_:

  • d7ue0a_ is new in SCOPe 2.08-stable