Lineage for d7suqa2 (7suq A:42-163)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941483Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
    Domain 1 is a WW-domain
  7. 2941484Species Human (Homo sapiens) [TaxId:9606] [54548] (52 PDB entries)
  8. 3086873Domain d7suqa2: 7suq A:42-163 [423190]
    Other proteins in same PDB: d7suqa1
    automated match to d1pina2

Details for d7suqa2

PDB Entry: 7suq (more details)

PDB Description: two-state solution nmr structure of pin1 bound to peptide ffpspr
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d7suqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7suqa2 d.26.1.1 (A:42-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
ssggkngqgeparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgee
dfeslasqfsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilr
te

SCOPe Domain Coordinates for d7suqa2:

Click to download the PDB-style file with coordinates for d7suqa2.
(The format of our PDB-style files is described here.)

Timeline for d7suqa2:

  • d7suqa2 is new in SCOPe 2.08-stable

3086873
d7suqa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d7suqa1