Lineage for d1d4cb3 (1d4c B:360-505)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139383Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)
  4. 139384Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) (S)
  5. 139385Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (4 proteins)
  6. 139390Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
  7. 139402Species Shewanella putrefaciens [TaxId:24] [56434] (3 PDB entries)
  8. 139404Domain d1d4cb3: 1d4c B:360-505 [42319]
    Other proteins in same PDB: d1d4ca1, d1d4ca2, d1d4cb1, d1d4cb2, d1d4cc1, d1d4cc2, d1d4cd1, d1d4cd2

Details for d1d4cb3

PDB Entry: 1d4c (more details), 2.9 Å

PDB Description: crystal structure of the uncomplexed form of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1

SCOP Domain Sequences for d1d4cb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4cb3 d.168.1.1 (B:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens}
yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqf
erpdlprelvvapfyaleiapavhht

SCOP Domain Coordinates for d1d4cb3:

Click to download the PDB-style file with coordinates for d1d4cb3.
(The format of our PDB-style files is described here.)

Timeline for d1d4cb3: