Lineage for d7suqa1 (7suq A:1-41)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811242Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2811243Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2811367Family b.72.1.0: automated matches [227264] (1 protein)
    not a true family
  6. 2811368Protein automated matches [227055] (4 species)
    not a true protein
  7. 2811369Species Human (Homo sapiens) [TaxId:9606] [226058] (20 PDB entries)
  8. 3086872Domain d7suqa1: 7suq A:1-41 [423189]
    Other proteins in same PDB: d7suqa2
    automated match to d1pina1

Details for d7suqa1

PDB Entry: 7suq (more details)

PDB Description: two-state solution nmr structure of pin1 bound to peptide ffpspr
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d7suqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7suqa1 b.72.1.0 (A:1-41) automated matches {Human (Homo sapiens) [TaxId: 9606]}
madeeklppgwekrmsrssgrvyyfnhitnasqwerpsgns

SCOPe Domain Coordinates for d7suqa1:

Click to download the PDB-style file with coordinates for d7suqa1.
(The format of our PDB-style files is described here.)

Timeline for d7suqa1:

  • d7suqa1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7suqa2