Lineage for d7tl0e_ (7tl0 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 3086868Domain d7tl0e_: 7tl0 E: [423185]
    Other proteins in same PDB: d7tl0j_, d7tl0l_, d7tl0n_
    automated match to d7orab_
    complexed with nag

Details for d7tl0e_

PDB Entry: 7tl0 (more details), 3.06 Å

PDB Description: cryo-em structure of hmpv pref bound by fabs mpe8 and san32-2
PDB Compounds: (E:) SAN32-2 Fab light chain

SCOPe Domain Sequences for d7tl0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7tl0e_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqginyylnwyqqkpgkapkvliydasdletgvps
rfsgggsgthftftisslqtedigtyycqqydnlpftfgqgtrle

SCOPe Domain Coordinates for d7tl0e_:

Click to download the PDB-style file with coordinates for d7tl0e_.
(The format of our PDB-style files is described here.)

Timeline for d7tl0e_:

  • d7tl0e_ is new in SCOPe 2.08-stable