Lineage for d1d4ca3 (1d4c A:360-505)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198685Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)
  4. 198686Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) (S)
  5. 198687Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (4 proteins)
  6. 198694Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
  7. 198709Species Shewanella putrefaciens [TaxId:24] [56434] (3 PDB entries)
  8. 198710Domain d1d4ca3: 1d4c A:360-505 [42318]
    Other proteins in same PDB: d1d4ca1, d1d4ca2, d1d4cb1, d1d4cb2, d1d4cc1, d1d4cc2, d1d4cd1, d1d4cd2

Details for d1d4ca3

PDB Entry: 1d4c (more details), 2.9 Å

PDB Description: crystal structure of the uncomplexed form of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1

SCOP Domain Sequences for d1d4ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4ca3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens}
yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqf
erpdlprelvvapfyaleiapavhht

SCOP Domain Coordinates for d1d4ca3:

Click to download the PDB-style file with coordinates for d1d4ca3.
(The format of our PDB-style files is described here.)

Timeline for d1d4ca3: