Lineage for d7sbdh_ (7sbd H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 3086857Domain d7sbdh_: 7sbd H: [423174]
    Other proteins in same PDB: d7sbdc1, d7sbdc2, d7sbdl_
    automated match to d4odth_

Details for d7sbdh_

PDB Entry: 7sbd (more details), 3.04 Å

PDB Description: murine fab/ige in complex with profilin from hevea brasieliensis (hev b 8)
PDB Compounds: (H:) Fab/IgE Heavy chain

SCOPe Domain Sequences for d7sbdh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7sbdh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesggglvqpkgslklscaasgftfntyamnwvrqapgkglewvarirtktnnyvt
yyadsvkdrftisrddsqsmlylqmnnlktedtamyycvrhvgdywgqgtsvtvssasir
npqlyplkpckgtasmtlgclvkdyfpgpvtvtwysdslnmstvnfpalgselkvttsqv
tswgksaknftchvthppsfnesrtilvr

SCOPe Domain Coordinates for d7sbdh_:

Click to download the PDB-style file with coordinates for d7sbdh_.
(The format of our PDB-style files is described here.)

Timeline for d7sbdh_:

  • d7sbdh_ is new in SCOPe 2.08-stable