Lineage for d1qo8d3 (1qo8 D:360-505)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198685Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)
  4. 198686Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) (S)
  5. 198687Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (4 proteins)
  6. 198694Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
  7. 198695Species Shewanella frigidimarina [TaxId:56812] [56433] (8 PDB entries)
  8. 198708Domain d1qo8d3: 1qo8 D:360-505 [42317]
    Other proteins in same PDB: d1qo8a1, d1qo8a2, d1qo8d1, d1qo8d2

Details for d1qo8d3

PDB Entry: 1qo8 (more details), 2.15 Å

PDB Description: the structure of the open conformation of a flavocytochrome c3 fumarate reductase

SCOP Domain Sequences for d1qo8d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo8d3 d.168.1.1 (D:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina}
hptvgkdsrilisetvrgvgavmvnkdgnrfiselttrdkasdailkqpgqfawiifdnq
lykkakmvrgydhlemlykgdtveqlakstgmkvadlaktvsdyngyvasgkdtafgrad
mplnmtqspyyavkvapgihhtmggv

SCOP Domain Coordinates for d1qo8d3:

Click to download the PDB-style file with coordinates for d1qo8d3.
(The format of our PDB-style files is described here.)

Timeline for d1qo8d3: