| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily) unusual fold |
Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) ![]() |
| Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins) |
| Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species) contains additional N-terminal multiheme domain |
| Species Shewanella frigidimarina [TaxId:56812] [56433] (16 PDB entries) |
| Domain d1qo8d3: 1qo8 D:360-505 [42317] Other proteins in same PDB: d1qo8a1, d1qo8a2, d1qo8d1, d1qo8d2 complexed with fad, hem has additional subdomain(s) that are not in the common domain |
PDB Entry: 1qo8 (more details), 2.15 Å
SCOPe Domain Sequences for d1qo8d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qo8d3 d.168.1.1 (D:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
hptvgkdsrilisetvrgvgavmvnkdgnrfiselttrdkasdailkqpgqfawiifdnq
lykkakmvrgydhlemlykgdtveqlakstgmkvadlaktvsdyngyvasgkdtafgrad
mplnmtqspyyavkvapgihhtmggv
Timeline for d1qo8d3: