Lineage for d1qo8d3 (1qo8 D:360-505)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001255Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 3001256Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 3001257Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 3001264Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
    contains additional N-terminal multiheme domain
  7. 3001265Species Shewanella frigidimarina [TaxId:56812] [56433] (16 PDB entries)
  8. 3001288Domain d1qo8d3: 1qo8 D:360-505 [42317]
    Other proteins in same PDB: d1qo8a1, d1qo8a2, d1qo8d1, d1qo8d2
    complexed with fad, hem
    has additional subdomain(s) that are not in the common domain

Details for d1qo8d3

PDB Entry: 1qo8 (more details), 2.15 Å

PDB Description: the structure of the open conformation of a flavocytochrome c3 fumarate reductase
PDB Compounds: (D:) flavocytochrome c3 fumarate reductase

SCOPe Domain Sequences for d1qo8d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo8d3 d.168.1.1 (D:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
hptvgkdsrilisetvrgvgavmvnkdgnrfiselttrdkasdailkqpgqfawiifdnq
lykkakmvrgydhlemlykgdtveqlakstgmkvadlaktvsdyngyvasgkdtafgrad
mplnmtqspyyavkvapgihhtmggv

SCOPe Domain Coordinates for d1qo8d3:

Click to download the PDB-style file with coordinates for d1qo8d3.
(The format of our PDB-style files is described here.)

Timeline for d1qo8d3: