SCOP 1.61: Domain d1qlba3: 1qlb A:251-371

Lineage for d1qlba3 (1qlb A:251-371)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)

4. Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family)

5. Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (4 proteins)

6. Protein Fumarate reductase flavoprotein subunit [56429] (2 species)

7. Species Wolinella succinogenes [TaxId:844] [56431] (3 PDB entries)

8. Domain d1qlba3: 1qlb A:251-371 [42312]
   Other proteins in same PDB: d1qlba1, d1qlba2, d1qlbb1, d1qlbb2, d1qlbc_, d1qlbd1, d1qlbd2, d1qlbe1, d1qlbe2, d1qlbf_

Details for d1qlba3

PDB Entry: 1qlb, 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes

SCOP Domain Sequences for d1qlba3:

Sequence; same for both SEQRES and ATOM records:

>d1qlba3 d.168.1.1 (A:251-371) Fumarate reductase flavoprotein subunit {Wolinella succinogenes}
meavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelasrdvvsrrmie
hirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaekwapvlpmqhy
s

Timeline for d1qlba3:

• d1qlba3 first appeared (with stable ids) in SCOP 1.55
  
• d1qlba3 appears in SCOP 1.59
  
• d1qlba3 appears in SCOP 1.63
  
• d1qlba3 appears in the current release, SCOPe 2.08