Lineage for d7pzff_ (7pzf F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022097Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 3022172Protein automated matches [190289] (7 species)
    not a true protein
  7. 3022224Species Klebsiella pneumoniae [TaxId:573] [340493] (7 PDB entries)
  8. 3086774Domain d7pzff_: 7pzf F: [423091]
    automated match to d1osma_
    complexed with c14, li

Details for d7pzff_

PDB Entry: 7pzf (more details), 1.5 Å

PDB Description: crystal structure of the ompk36 td insertion chimera from klebsiella pneumonia
PDB Compounds: (F:) ompk36

SCOPe Domain Sequences for d7pzff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7pzff_ f.4.3.1 (F:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gaeiynkdgnkldlygkidglhyfsddksvdgdqtymrvgvkgetqindqltgygqweyn
vqanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtdtyg
sdnflqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgwskqngdgf
gtsltydiwdgisagfayshskrtdeqnsvpalgrgdnaetytgglkydanniylasqyt
qtynatragslgfankaqnfevvaqyqfdfglrpsvaylqskgkdlergygdqdilkyvd
vgatyyfnknmstyvdykinllddnsftrnagistddvvalglvyqf

SCOPe Domain Coordinates for d7pzff_:

Click to download the PDB-style file with coordinates for d7pzff_.
(The format of our PDB-style files is described here.)

Timeline for d7pzff_:

  • d7pzff_ is new in SCOPe 2.08-stable