Lineage for d1fuma3 (1fum A:226-357)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37295Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)
  4. 37296Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) (S)
  5. 37297Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (3 proteins)
  6. 37311Protein Fumarate reductase flavoprotein subunit [56429] (2 species)
  7. 37312Species Escherichia coli [TaxId:562] [56430] (1 PDB entry)
  8. 37313Domain d1fuma3: 1fum A:226-357 [42308]
    Other proteins in same PDB: d1fuma1, d1fuma2, d1fumb1, d1fumb2, d1fumc_, d1fumd_, d1fumm1, d1fumm2, d1fumn1, d1fumn2, d1fumo_, d1fump_

Details for d1fuma3

PDB Entry: 1fum (more details), 3.3 Å

PDB Description: structure of the e. coli fumarate reductase respiratory complex

SCOP Domain Sequences for d1fuma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fuma3 d.168.1.1 (A:226-357) Fumarate reductase flavoprotein subunit {Escherichia coli}
mefvqyhptglpgsgilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelg
prdkvsqafwhewrkgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvk
epipvrptahyt

SCOP Domain Coordinates for d1fuma3:

Click to download the PDB-style file with coordinates for d1fuma3.
(The format of our PDB-style files is described here.)

Timeline for d1fuma3: