Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein M (medium) subunit [81481] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries) Uniprot P02953 |
Domain d7p17m_: 7p17 M: [423075] Other proteins in same PDB: d7p17h1, d7p17h2, d7p17l_ automated match to d4n7km_ complexed with bcl, bph, edo, fe, lda, mys, nkp, olc, spn, u10; mutant |
PDB Entry: 7p17 (more details), 2.22 Å
SCOPe Domain Sequences for d7p17m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7p17m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} eyqniftqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslf sglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasff mfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifs hldwtnnfslvhgnlhynpfhglsiaflygsallfamhgatilavsrfggereleqiadr gtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh g
Timeline for d7p17m_: