Lineage for d7p17m_ (7p17 M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027382Protein M (medium) subunit [81481] (4 species)
  7. 3027383Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
    Uniprot P02953
  8. 3086758Domain d7p17m_: 7p17 M: [423075]
    Other proteins in same PDB: d7p17h1, d7p17h2, d7p17l_
    automated match to d4n7km_
    complexed with bcl, bph, edo, fe, lda, mys, nkp, olc, spn, u10; mutant

Details for d7p17m_

PDB Entry: 7p17 (more details), 2.22 Å

PDB Description: f(m197)h mutant structure of photosynthetic reaction center from rhodobacter sphaeroides strain rv by fixed-target serial synchrotron crystallography (room temperature, 12kev)
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d7p17m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7p17m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
eyqniftqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslf
sglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasff
mfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifs
hldwtnnfslvhgnlhynpfhglsiaflygsallfamhgatilavsrfggereleqiadr
gtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh
g

SCOPe Domain Coordinates for d7p17m_:

Click to download the PDB-style file with coordinates for d7p17m_.
(The format of our PDB-style files is described here.)

Timeline for d7p17m_:

  • d7p17m_ is new in SCOPe 2.08-stable