Lineage for d8ahha1 (8ahh A:300-591)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 3086745Domain d8ahha1: 8ahh A:300-591 [423062]
    Other proteins in same PDB: d8ahha2
    automated match to d2q0na_
    complexed with m4x

Details for d8ahha1

PDB Entry: 8ahh (more details), 2.04 Å

PDB Description: pac fragmentdel: photoactivated covalent capture of dna encoded fragments for hit discovery
PDB Compounds: (A:) serine/threonine-protein kinase pak 4

SCOPe Domain Sequences for d8ahha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8ahha1 d.144.1.0 (A:300-591) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sheqfraalqavvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqqr
rellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqiaa
vclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvgtp
ywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknlh
kvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnrtr

SCOPe Domain Coordinates for d8ahha1:

Click to download the PDB-style file with coordinates for d8ahha1.
(The format of our PDB-style files is described here.)

Timeline for d8ahha1:

  • d8ahha1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d8ahha2