SCOPe 2.08: Domain d7p17h2: 7p17 H:36-250

Lineage for d7p17h2 (7p17 H:36-250)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
   Uniprot P11846

8. Domain d7p17h2: 7p17 H:36-250 [423061]
   Other proteins in same PDB: d7p17h1, d7p17l_, d7p17m_
   automated match to d2j8dh2
   complexed with bcl, bph, edo, fe, lda, mys, nkp, olc, spn, u10; mutant

Details for d7p17h2

PDB Entry: 7p17, 2.22 Å

PDB Description: f(m197)h mutant structure of photosynthetic reaction center from rhodobacter sphaeroides strain rv by fixed-target serial synchrotron crystallography (room temperature, 12kev)

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d7p17h2:

Sequence; same for both SEQRES and ATOM records:

>d7p17h2 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d7p17h2:

• d7p17h2 is new in SCOPe 2.08-stable