Lineage for d8dilb_ (8dil B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 3086666Species Salmonella enterica [TaxId:216597] [422983] (1 PDB entry)
  8. 3086702Domain d8dilb_: 8dil B: [423019]
    automated match to d3e10b_
    complexed with cit, edo, fmn, peg, pge

Details for d8dilb_

PDB Entry: 8dil (more details), 1.8 Å

PDB Description: crystal structure of putative nitroreductase from salmonella enterica
PDB Compounds: (B:) Putative NAD(P)H nitroreductase

SCOPe Domain Sequences for d8dilb_:

Sequence, based on SEQRES records: (download)

>d8dilb_ d.90.1.0 (B:) automated matches {Salmonella enterica [TaxId: 216597]}
mdalellvnrrsasrlaepapvgeqlqnilragmrvpdhkslqpwrffviegegrdrfsa
vleqgavaaggdekaiekarnapfrapliitvvakceenhkvpvweqemsagcavmamqm
aaiaqgfngiwrsgaltesaivreafecrpqdkivgflylgtpqlkasttistpdptpfv
ryf

Sequence, based on observed residues (ATOM records): (download)

>d8dilb_ d.90.1.0 (B:) automated matches {Salmonella enterica [TaxId: 216597]}
mdalellvnrrsasrlaepapvgeqlqnilragmrvpdhkslqpwrffviegegrdrfsa
vleqgavaaggdekaiekarnapfrapliitvvakceenhkvpvweqemsagcavmamqm
aaiaqgfngiwrsgaltesaivreafecrpqdkivgflylgtpqpdptpfvryf

SCOPe Domain Coordinates for d8dilb_:

Click to download the PDB-style file with coordinates for d8dilb_.
(The format of our PDB-style files is described here.)

Timeline for d8dilb_:

  • d8dilb_ is new in SCOPe 2.08-stable