Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
Protein automated matches [190672] (32 species) not a true protein |
Species Salmonella enterica [TaxId:216597] [422983] (1 PDB entry) |
Domain d8dilb_: 8dil B: [423019] automated match to d3e10b_ complexed with cit, edo, fmn, peg, pge |
PDB Entry: 8dil (more details), 1.8 Å
SCOPe Domain Sequences for d8dilb_:
Sequence, based on SEQRES records: (download)
>d8dilb_ d.90.1.0 (B:) automated matches {Salmonella enterica [TaxId: 216597]} mdalellvnrrsasrlaepapvgeqlqnilragmrvpdhkslqpwrffviegegrdrfsa vleqgavaaggdekaiekarnapfrapliitvvakceenhkvpvweqemsagcavmamqm aaiaqgfngiwrsgaltesaivreafecrpqdkivgflylgtpqlkasttistpdptpfv ryf
>d8dilb_ d.90.1.0 (B:) automated matches {Salmonella enterica [TaxId: 216597]} mdalellvnrrsasrlaepapvgeqlqnilragmrvpdhkslqpwrffviegegrdrfsa vleqgavaaggdekaiekarnapfrapliitvvakceenhkvpvweqemsagcavmamqm aaiaqgfngiwrsgaltesaivreafecrpqdkivgflylgtpqpdptpfvryf
Timeline for d8dilb_: