SCOPe 2.08: Domain d8ahea_: 8ahe A:

Lineage for d8ahea_ (8ahe A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 proteins)
   automatically mapped to Pfam PF02350

6. Protein automated matches [197010] (4 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:1392] [423004] (1 PDB entry)

8. Domain d8ahea_: 8ahe A: [423005]
   automated match to d3ot5b_
   protein/DNA complex; complexed with m2u, so4

Details for d8ahea_

PDB Entry: 8ahe, 2.11 Å

PDB Description: pac-fragmentdel: photoactivated covalent capture of dna encoded fragments for hit discovery

PDB Compounds: (A:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d8ahea_:

Sequence; same for both SEQRES and ATOM records:

>d8ahea_ c.87.1.3 (A:) automated matches {Bacillus anthracis [TaxId: 1392]}
erlkvmtifgtrpeaikmaplvlelqkhpekiesivtvtaqhrqmldqvlsifgitpdfd
lnimkdrqtlidittrglegldkvmkeakpdivlvhgdttttfiaslaafynqipvghve
aglrtwdkyspypeemnrqltgvmadlhfsptaksatnlqkenkdesrifitgntaidal
kttvketyshpvleklgnnrlvlmtahrrenlgepmrnmfraikrlvdkhedvqvvypvh
mnpvvretandilgdygrihliepldvidfhnvaarsylmltdsggvqeeapslgvpvlv
lrdtterpegieagtlklagtdeetifsladellsdkeahdkmskasnpygdgraseriv
eailkhfnk

Timeline for d8ahea_:

• d8ahea_ is new in SCOPe 2.08-stable