Lineage for d8a0ub_ (8a0u B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766067Family b.1.18.26: TEAD-like transcription factors, E-set domain [418817] (2 proteins)
    Pfam PF17725
  6. 2766080Protein automated matches [419244] (2 species)
    not a true protein
  7. 2766081Species Human (Homo sapiens) [TaxId:9606] [419859] (24 PDB entries)
  8. 3086674Domain d8a0ub_: 8a0u B: [422991]
    automated match to d6ge6a_
    complexed with kmu, myr, po4

Details for d8a0ub_

PDB Entry: 8a0u (more details), 2.9 Å

PDB Description: crystal structure of tead3 in complex with cpd4
PDB Compounds: (B:) Transcriptional enhancer factor TEF-5

SCOPe Domain Sequences for d8a0ub_:

Sequence, based on SEQRES records: (download)

>d8a0ub_ b.1.18.26 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtiassrlrlleysafmevqrdpdtyskhlfvhigqtnpafsdppleavdvrqiydkfpe
kkgglkelyekgppnafflvkfwadlnstiqegpgafygvssqyssadsmtisvstkvcs
fgkqvvekveteyarlengrfvyrihrspmceyminfihklkhlpekymmnsvlenftil
qvvtsrdsqetllviafvfevstsehgaqhhvyklvkd

Sequence, based on observed residues (ATOM records): (download)

>d8a0ub_ b.1.18.26 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtiassrlrlleysafmevqrdpdtyskhlfvhigqtpleavdvrqiydkfpekkgglke
lyekgppnafflvkfwadlnstiqegafygvssqyssadsmtisvstkvcsfgkqvvekv
eteyarlengrfvyrihrspmceyminfihklkhlpekymmnsvlenftilqvvtsrdsq
etllviafvfevstsehgaqhhvyklvkd

SCOPe Domain Coordinates for d8a0ub_:

Click to download the PDB-style file with coordinates for d8a0ub_.
(The format of our PDB-style files is described here.)

Timeline for d8a0ub_:

  • d8a0ub_ is new in SCOPe 2.08-stable