Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.26: TEAD-like transcription factors, E-set domain [418817] (2 proteins) Pfam PF17725 |
Protein automated matches [419244] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [419859] (24 PDB entries) |
Domain d8a0ub_: 8a0u B: [422991] automated match to d6ge6a_ complexed with kmu, myr, po4 |
PDB Entry: 8a0u (more details), 2.9 Å
SCOPe Domain Sequences for d8a0ub_:
Sequence, based on SEQRES records: (download)
>d8a0ub_ b.1.18.26 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtiassrlrlleysafmevqrdpdtyskhlfvhigqtnpafsdppleavdvrqiydkfpe kkgglkelyekgppnafflvkfwadlnstiqegpgafygvssqyssadsmtisvstkvcs fgkqvvekveteyarlengrfvyrihrspmceyminfihklkhlpekymmnsvlenftil qvvtsrdsqetllviafvfevstsehgaqhhvyklvkd
>d8a0ub_ b.1.18.26 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtiassrlrlleysafmevqrdpdtyskhlfvhigqtpleavdvrqiydkfpekkgglke lyekgppnafflvkfwadlnstiqegafygvssqyssadsmtisvstkvcsfgkqvvekv eteyarlengrfvyrihrspmceyminfihklkhlpekymmnsvlenftilqvvtsrdsq etllviafvfevstsehgaqhhvyklvkd
Timeline for d8a0ub_: