Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (61 species) not a true protein |
Species Mycobacteroides abscessus [TaxId:36809] [422913] (1 PDB entry) |
Domain d7yy5b_: 7yy5 B: [422925] Other proteins in same PDB: d7yy5a2 automated match to d5o08a_ complexed with i7l |
PDB Entry: 7yy5 (more details), 1.5 Å
SCOPe Domain Sequences for d7yy5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7yy5b_ c.26.1.0 (B:) automated matches {Mycobacteroides abscessus [TaxId: 36809]} mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemirestad lpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap aysfvssslakevatyggdvsallpasvhqrllgklr
Timeline for d7yy5b_: