Lineage for d1icjc_ (1icj C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514178Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 514179Superfamily d.167.1: Peptide deformylase [56420] (1 family) (S)
    nickel-dependent enzyme
  5. 514180Family d.167.1.1: Peptide deformylase [56421] (1 protein)
  6. 514181Protein Peptide deformylase [56422] (8 species)
  7. 514184Species Escherichia coli [TaxId:562] [56423] (15 PDB entries)
  8. 514196Domain d1icjc_: 1icj C: [42286]

Details for d1icjc_

PDB Entry: 1icj (more details), 1.9 Å

PDB Description: pdf protein is crystallized as ni2+ containing form, cocrystallized with inhibitor polyethylene glycol (peg)

SCOP Domain Sequences for d1icjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1icjc_ d.167.1.1 (C:) Peptide deformylase {Escherichia coli}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara

SCOP Domain Coordinates for d1icjc_:

Click to download the PDB-style file with coordinates for d1icjc_.
(The format of our PDB-style files is described here.)

Timeline for d1icjc_: