Lineage for d7llqa1 (7llq A:3-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820569Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 2820585Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 2820586Species Human (Homo sapiens) [TaxId:9606] [63740] (58 PDB entries)
    Uniprot P09960
  8. 3086526Domain d7llqa1: 7llq A:3-208 [422843]
    Other proteins in same PDB: d7llqa2, d7llqa3, d7llqb2, d7llqb3, d7llqc2, d7llqc3
    automated match to d1hs6a2
    complexed with 28t, n0y, zn

Details for d7llqa1

PDB Entry: 7llq (more details), 2.85 Å

PDB Description: substrate-dependent divergence of leukotriene a4 hydrolase aminopeptidase activity
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d7llqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7llqa1 b.98.1.1 (A:3-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltie
kvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeq
tsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpe
dpsrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d7llqa1:

Click to download the PDB-style file with coordinates for d7llqa1.
(The format of our PDB-style files is described here.)

Timeline for d7llqa1:

  • d7llqa1 is new in SCOPe 2.08-stable