Lineage for d4paxa2 (4pax A:797-1011)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606598Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 2606599Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 2606600Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries)
  8. 2606606Domain d4paxa2: 4pax A:797-1011 [42280]
    Other proteins in same PDB: d4paxa1
    complexed with nu1

Details for d4paxa2

PDB Entry: 4pax (more details), 2.8 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with 8-hydroxy-2-methyl-3-hydro-quinazolin-4-one
PDB Compounds: (A:) poly(ADP-ribose) polymerase

SCOPe Domain Sequences for d4paxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4paxa2 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfnykt

SCOPe Domain Coordinates for d4paxa2:

Click to download the PDB-style file with coordinates for d4paxa2.
(The format of our PDB-style files is described here.)

Timeline for d4paxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4paxa1