Lineage for d7puqd_ (7puq D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892965Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins)
    lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain
  6. 2892996Protein automated matches [254715] (3 species)
    not a true protein
  7. 2893070Species Mouse (Mus musculus) [TaxId:10090] [419966] (5 PDB entries)
  8. 3086463Domain d7puqd_: 7puq D: [422780]
    automated match to d2y1xa_
    complexed with 867, edo

Details for d7puqd_

PDB Entry: 7puq (more details), 2.09 Å

PDB Description: carm1 in complex with eml982
PDB Compounds: (D:) histone-arginine methyltransferase carm1

SCOPe Domain Sequences for d7puqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7puqd_ c.66.1.6 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
svfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcg
sgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdii
isepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwy
qpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipf
kfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtl
sgtclliankrqsydisivaqvdqtgskssnlldlknpffry

SCOPe Domain Coordinates for d7puqd_:

Click to download the PDB-style file with coordinates for d7puqd_.
(The format of our PDB-style files is described here.)

Timeline for d7puqd_:

  • d7puqd_ is new in SCOPe 2.08-stable