Lineage for d7mo3a_ (7mo3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867618Protein Ran [52609] (2 species)
  7. 2867639Species Human (Homo sapiens) [TaxId:9606] [52611] (90 PDB entries)
  8. 3086442Domain d7mo3a_: 7mo3 A: [422759]
    Other proteins in same PDB: d7mo3b1, d7mo3b2, d7mo3d1, d7mo3d2
    automated match to d2mmca_
    complexed with gdp, mg, zn

Details for d7mo3a_

PDB Entry: 7mo3 (more details), 2.05 Å

PDB Description: crystal structure of the znf3 of nucleoporin nup153 in complex with ran-gdp, resolution 2.05 angstrom
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d7mo3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mo3a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
pqvqfklvlvgdggtgkttfvkrhltgesekkyvatlgvevhplvfhtnrgpikfnvwdt
agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappe
vvmdpalaaqyehdlevaqttalp

SCOPe Domain Coordinates for d7mo3a_:

Click to download the PDB-style file with coordinates for d7mo3a_.
(The format of our PDB-style files is described here.)

Timeline for d7mo3a_:

  • d7mo3a_ is new in SCOPe 2.08-stable