Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (10 species) not a true protein |
Species Cereibacter sphaeroides [TaxId:272943] [422688] (1 PDB entry) |
Domain d7vnmu_: 7vnm U: [422753] Other proteins in same PDB: d7vnm0_, d7vnm2_, d7vnm8_, d7vnmb_, d7vnmc_, d7vnme_, d7vnmg_, d7vnmj_, d7vnml_, d7vnmm_, d7vnmn_, d7vnmp_, d7vnmr_, d7vnmt_, d7vnmv_ automated match to d7ddqd_ complexed with bcl, bph, cdl, fe2, pc1, spo, u10 |
PDB Entry: 7vnm (more details), 2.86 Å
SCOPe Domain Sequences for d7vnmu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7vnmu_ f.3.1.0 (U:) automated matches {Cereibacter sphaeroides [TaxId: 272943]} mskfykiwmifdprrvfvaqgvflfllavmihlillstpsynwleisaakynrv
Timeline for d7vnmu_:
View in 3D Domains from other chains: (mouse over for more information) d7vnm0_, d7vnm1_, d7vnm2_, d7vnm7_, d7vnm8_, d7vnm9_, d7vnma_, d7vnmb_, d7vnmc_, d7vnmd_, d7vnme_, d7vnmf_, d7vnmg_, d7vnmi_, d7vnmj_, d7vnmk_, d7vnml_, d7vnmm_, d7vnmn_, d7vnmo_, d7vnmp_, d7vnmq_, d7vnmr_, d7vnms_, d7vnmt_, d7vnmv_, d7vnmw_ |