Lineage for d7vnmu_ (7vnm U:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021656Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 3021657Protein automated matches [254444] (10 species)
    not a true protein
  7. 3086371Species Cereibacter sphaeroides [TaxId:272943] [422688] (1 PDB entry)
  8. 3086436Domain d7vnmu_: 7vnm U: [422753]
    Other proteins in same PDB: d7vnm0_, d7vnm2_, d7vnm8_, d7vnmb_, d7vnmc_, d7vnme_, d7vnmg_, d7vnmj_, d7vnml_, d7vnmm_, d7vnmn_, d7vnmp_, d7vnmr_, d7vnmt_, d7vnmv_
    automated match to d7ddqd_
    complexed with bcl, bph, cdl, fe2, pc1, spo, u10

Details for d7vnmu_

PDB Entry: 7vnm (more details), 2.86 Å

PDB Description: rba sphaeroides pufy-ko rc-lh1 monomer
PDB Compounds: (U:) Light-harvesting protein B-875 alpha chain

SCOPe Domain Sequences for d7vnmu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vnmu_ f.3.1.0 (U:) automated matches {Cereibacter sphaeroides [TaxId: 272943]}
mskfykiwmifdprrvfvaqgvflfllavmihlillstpsynwleisaakynrv

SCOPe Domain Coordinates for d7vnmu_:

Click to download the PDB-style file with coordinates for d7vnmu_.
(The format of our PDB-style files is described here.)

Timeline for d7vnmu_:

  • d7vnmu_ is new in SCOPe 2.08-stable