Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species) contains an extra alpha-helical domain |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385979] (354 PDB entries) |
Domain d7wohb_: 7woh B: [422737] automated match to d7e18a_ complexed with 5iw |
PDB Entry: 7woh (more details), 1.72 Å
SCOPe Domain Sequences for d7wohb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7wohb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} sgfrkmafpsgkvegcmvqvtcgtttlnglwlddvvycprhvictsedmlnpnyedllir ksnhnflvqagnvqlrvighsmqncvlklkvdtanpktpkykfvriqpgqtfsvlacyng spsgvyqcamrpnftikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegn fygpfvdrqtaqaagtdttitvnvlawlyaavingdrwflnrftttlndfnlvamkynye pltqdhvdilgplsaqtgiavldmcaslkellqngmngrtilgsalledeftpfdvvrqc sgv
Timeline for d7wohb_: