SCOPe 2.08: Domain d7t0ke1: 7t0k E:1-108

Lineage for d7t0ke1 (7t0k E:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (52 PDB entries)

8. Domain d7t0ke1: 7t0k E:1-108 [422704]
   Other proteins in same PDB: d7t0ka2, d7t0kc2, d7t0ke2, d7t0kl2
   automated match to d1q9ka1
   complexed with iod

Details for d7t0ke1

PDB Entry: 7t0k, 2 Å

PDB Description: crystal structure of s25-2 fab unliganded 4

PDB Compounds: (E:) S25-2 Fab light chain

SCOPe Domain Sequences for d7t0ke1:

Sequence; same for both SEQRES and ATOM records:

>d7t0ke1 b.1.1.1 (E:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikr

Timeline for d7t0ke1:

• d7t0ke1 is new in SCOPe 2.08-stable