SCOPe 2.08: Domain d7p0td2: 7p0t D:182-274

Lineage for d7p0td2 (7p0t D:182-274)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
   Uniprot P01901 22-299

8. Domain d7p0td2: 7p0t D:182-274 [422653]
   Other proteins in same PDB: d7p0ta1, d7p0tb_, d7p0td1, d7p0te_
   automated match to d1n5aa1
   complexed with cl, so4

Details for d7p0td2

PDB Entry: 7p0t, 2.61 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 peptide with d- aminoacid

PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d7p0td2:

Sequence, based on SEQRES records:

>d7p0td2 b.1.1.2 (D:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Sequence, based on observed residues (ATOM records):

>d7p0td2 b.1.1.2 (D:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqqdmelvetrpagdgtfqkwasvv
vplqnytcrvyheglpepltlrw

Timeline for d7p0td2:

• d7p0td2 is new in SCOPe 2.08-stable