SCOPe 2.08: Domain d7nvmk2: 7nvm K:147-375

Lineage for d7nvmk2 (7nvm K:147-375)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries)

8. Domain d7nvmk2: 7nvm K:147-375 [422650]
   Other proteins in same PDB: d7nvmk1, d7nvmn1, d7nvmn2
   automated match to d3ub5a2
   complexed with adp, af3, mg

Details for d7nvmk2

PDB Entry: 7nvm, 3.1 Å

PDB Description: human tric complex in closed state with nanobody nb18, actin and phlp2a bound

PDB Compounds: (K:) Actin, cytoplasmic 2

SCOPe Domain Sequences for d7nvmk2:

Sequence, based on SEQRES records:

>d7nvmk2 c.55.1.1 (K:147-375) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf

Sequence, based on observed residues (ATOM records):

>d7nvmk2 c.55.1.1 (K:147-375) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkitttaereivrdike
klcyvaldfeqematalfqpsflgmescgihettfnsimkcdvdirkdlyantvlsggtt
mypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwiskqeyde
sgpsivhrkcf

Timeline for d7nvmk2:

• d7nvmk2 is new in SCOPe 2.08-stable