Lineage for d7vyqf1 (7vyq F:1-279)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846492Species Candida parapsilosis [TaxId:5480] [195408] (3 PDB entries)
  8. 3086294Domain d7vyqf1: 7vyq F:1-279 [422611]
    Other proteins in same PDB: d7vyqa2, d7vyqb2, d7vyqf2, d7vyqg2
    automated match to d3ctmb_
    complexed with 83i, nap

Details for d7vyqf1

PDB Entry: 7vyq (more details), 3.13 Å

PDB Description: short chain dehydrogenase (scr) cryoem structure with nadp and ethyl 4-chloroacetoacetate
PDB Compounds: (F:) carbonyl reductase

SCOPe Domain Sequences for d7vyqf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vyqf1 c.2.1.0 (F:1-279) automated matches {Candida parapsilosis [TaxId: 5480]}
mgeiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagad
vaiwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanag
vtwtqgpeidvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkivni
pqlqapyntakaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltp
lgregltqelvggylylasnastfttgsdvvidggytcp

SCOPe Domain Coordinates for d7vyqf1:

Click to download the PDB-style file with coordinates for d7vyqf1.
(The format of our PDB-style files is described here.)

Timeline for d7vyqf1:

  • d7vyqf1 is new in SCOPe 2.08-stable