SCOPe 2.08: Domain d7f2ja1: 7f2j A:362-477

Lineage for d7f2ja1 (7f2j A:362-477)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225164] (4 PDB entries)

8. Domain d7f2ja1: 7f2j A:362-477 [422583]
   Other proteins in same PDB: d7f2ja2, d7f2jb2
   automated match to d2ki3a_
   complexed with peg, rap, so4

Details for d7f2ja1

PDB Entry: 7f2j, 1.6 Å

PDB Description: crystal structure of atfkbp53 fkbd in complex with rapamycin

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP53

SCOPe Domain Sequences for d7f2ja1:

Sequence; same for both SEQRES and ATOM records:

>d7f2ja1 d.26.1.0 (A:362-477) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sqvrtypngliveelsmgkpngkradpgktvsvryigklqkngkifdsnigkspfkfrlg
igsvikgwdvgvngmrvgdkrkltippsmgygvkgaggqippnswltfdvelinvq

Timeline for d7f2ja1:

• d7f2ja1 is new in SCOPe 2.08-stable