Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d7s0bb_: 7s0b B: [422572] Other proteins in same PDB: d7s0ba_, d7s0bc_, d7s0be_, d7s0bf_ automated match to d7orbb_ protein/RNA complex; complexed with nag |
PDB Entry: 7s0b (more details), 2.9 Å
SCOPe Domain Sequences for d7s0bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7s0bb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvps rfsgsgsgtdftftisslqpediatyycqqdagtpltfgqgtkveikrtvaapsvfifpp sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt lskadyekhkvyacevthqglsspvtksfnrge
Timeline for d7s0bb_: