Lineage for d7s0bb_ (7s0b B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 3086255Domain d7s0bb_: 7s0b B: [422572]
    Other proteins in same PDB: d7s0ba_, d7s0bc_, d7s0be_, d7s0bf_
    automated match to d7orbb_
    protein/RNA complex; complexed with nag

Details for d7s0bb_

PDB Entry: 7s0b (more details), 2.9 Å

PDB Description: structure of the sars-cov-2 rbd in complex with neutralizing antibody n-612-056
PDB Compounds: (B:) N-612-056 Light Chain

SCOPe Domain Sequences for d7s0bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7s0bb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvps
rfsgsgsgtdftftisslqpediatyycqqdagtpltfgqgtkveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d7s0bb_:

Click to download the PDB-style file with coordinates for d7s0bb_.
(The format of our PDB-style files is described here.)

Timeline for d7s0bb_:

  • d7s0bb_ is new in SCOPe 2.08-stable