Lineage for d1ptoa_ (1pto A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85464Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 85465Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 85466Family d.166.1.1: ADP-ribosylating toxins [56400] (7 proteins)
  6. 85507Protein Pertussis toxin, S1 subunit [56408] (1 species)
  7. 85508Species Bordetella pertussis [TaxId:520] [56409] (3 PDB entries)
  8. 85513Domain d1ptoa_: 1pto A: [42257]
    Other proteins in same PDB: d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptod_, d1ptoe_, d1ptof_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptoj_, d1ptok_, d1ptol_

Details for d1ptoa_

PDB Entry: 1pto (more details), 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding

SCOP Domain Sequences for d1ptoa_:

Sequence, based on SEQRES records: (download)

>d1ptoa_ d.166.1.1 (A:) Pertussis toxin, S1 subunit {Bordetella pertussis}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf

Sequence, based on observed residues (ATOM records): (download)

>d1ptoa_ d.166.1.1 (A:) Pertussis toxin, S1 subunit {Bordetella pertussis}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf

SCOP Domain Coordinates for d1ptoa_:

Click to download the PDB-style file with coordinates for d1ptoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ptoa_: