Lineage for d1bcpg_ (1bcp G:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85464Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 85465Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 85466Family d.166.1.1: ADP-ribosylating toxins [56400] (7 proteins)
  6. 85507Protein Pertussis toxin, S1 subunit [56408] (1 species)
  7. 85508Species Bordetella pertussis [TaxId:520] [56409] (3 PDB entries)
  8. 85512Domain d1bcpg_: 1bcp G: [42256]
    Other proteins in same PDB: d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpd_, d1bcpe_, d1bcpf_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpj_, d1bcpk_, d1bcpl_

Details for d1bcpg_

PDB Entry: 1bcp (more details), 2.7 Å

PDB Description: binary complex of pertussis toxin and atp

SCOP Domain Sequences for d1bcpg_:

Sequence, based on SEQRES records: (download)

>d1bcpg_ d.166.1.1 (G:) Pertussis toxin, S1 subunit {Bordetella pertussis}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf

Sequence, based on observed residues (ATOM records): (download)

>d1bcpg_ d.166.1.1 (G:) Pertussis toxin, S1 subunit {Bordetella pertussis}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf

SCOP Domain Coordinates for d1bcpg_:

Click to download the PDB-style file with coordinates for d1bcpg_.
(The format of our PDB-style files is described here.)

Timeline for d1bcpg_: