Lineage for d1prta_ (1prt A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85464Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 85465Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 85466Family d.166.1.1: ADP-ribosylating toxins [56400] (7 proteins)
  6. 85507Protein Pertussis toxin, S1 subunit [56408] (1 species)
  7. 85508Species Bordetella pertussis [TaxId:520] [56409] (3 PDB entries)
  8. 85509Domain d1prta_: 1prt A: [42253]
    Other proteins in same PDB: d1prtb1, d1prtb2, d1prtc1, d1prtc2, d1prtd_, d1prte_, d1prtf_, d1prth1, d1prth2, d1prti1, d1prti2, d1prtj_, d1prtk_, d1prtl_

Details for d1prta_

PDB Entry: 1prt (more details), 2.9 Å

PDB Description: the crystal structure of pertussis toxin

SCOP Domain Sequences for d1prta_:

Sequence, based on SEQRES records: (download)

>d1prta_ d.166.1.1 (A:) Pertussis toxin, S1 subunit {Bordetella pertussis}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf

Sequence, based on observed residues (ATOM records): (download)

>d1prta_ d.166.1.1 (A:) Pertussis toxin, S1 subunit {Bordetella pertussis}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf

SCOP Domain Coordinates for d1prta_:

Click to download the PDB-style file with coordinates for d1prta_.
(The format of our PDB-style files is described here.)

Timeline for d1prta_: