Lineage for d7eeja_ (7eej A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 3086204Species Chaetomium sp. [TaxId:1769349] [422521] (2 PDB entries)
  8. 3086212Domain d7eeja_: 7eej A: [422529]
    automated match to d3vl9a_
    complexed with bma, gol

Details for d7eeja_

PDB Entry: 7eej (more details), 1.48 Å

PDB Description: complex structure of glycoside hydrolase family 12 beta-1,3-1,4- glucanase with cellobiose
PDB Compounds: (A:) glycoside hydrolase family 12 beta-1,3-1,4-glucanase

SCOPe Domain Sequences for d7eeja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7eeja_ b.29.1.0 (A:) automated matches {Chaetomium sp. [TaxId: 1769349]}
qqvtlceqygywsgngyeinnnlwgrdsatsgwqcsyldgssdsgiqwhttwewqggqhd
vksyvysgkqfprgqritsinsmqtsvswyydttnvranvaydiftaadpnhvnssgdye
lmiwlakygdvqpigspvgtvhvngrnwelwigmngnmkvfsfiapsplnswsgevkeff
nylqynqgypagdqhlivfqmgteaftggpatmtvshfsaniy

SCOPe Domain Coordinates for d7eeja_:

Click to download the PDB-style file with coordinates for d7eeja_.
(The format of our PDB-style files is described here.)

Timeline for d7eeja_:

  • d7eeja_ is new in SCOPe 2.08-stable