Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Chaetomium sp. [TaxId:1769349] [422521] (2 PDB entries) |
Domain d7eeja_: 7eej A: [422529] automated match to d3vl9a_ complexed with bma, gol |
PDB Entry: 7eej (more details), 1.48 Å
SCOPe Domain Sequences for d7eeja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7eeja_ b.29.1.0 (A:) automated matches {Chaetomium sp. [TaxId: 1769349]} qqvtlceqygywsgngyeinnnlwgrdsatsgwqcsyldgssdsgiqwhttwewqggqhd vksyvysgkqfprgqritsinsmqtsvswyydttnvranvaydiftaadpnhvnssgdye lmiwlakygdvqpigspvgtvhvngrnwelwigmngnmkvfsfiapsplnswsgevkeff nylqynqgypagdqhlivfqmgteaftggpatmtvshfsaniy
Timeline for d7eeja_: