SCOPe 2.08: Domain d7ppsa2: 7pps A:250-404

Lineage for d7ppsa2 (7pps A:250-404)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208963] [422492] (1 PDB entry)

8. Domain d7ppsa2: 7pps A:250-404 [422507]
   automated match to d3mqda2
   complexed with cl, edo, iod; mutant

Details for d7ppsa2

PDB Entry: 7pps, 1.3 Å

PDB Description: apo fabb from pseudomonas aeruginosa with single point mutation c161a

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d7ppsa2:

Sequence; same for both SEQRES and ATOM records:

>d7ppsa2 c.95.1.0 (A:250-404) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
kiyaeivgygatsdgydmvapsgegaircmqqalatvdapidylnthgtstpvgdvaeir
gvrevfgdkapaisstkslsghslgaagvheaiycllmmeggfiagsanideldpevadl
pilretrenakldtvmsnsfgfggtnatlvlkrwq

Timeline for d7ppsa2:

• d7ppsa2 is new in SCOPe 2.08-stable