Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208963] [422492] (1 PDB entry) |
Domain d7ppsa1: 7pps A:1-249 [422506] automated match to d3mqda1 complexed with cl, edo, iod; mutant |
PDB Entry: 7pps (more details), 1.3 Å
SCOPe Domain Sequences for d7ppsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ppsa1 c.95.1.0 (A:1-249) automated matches {Pseudomonas aeruginosa [TaxId: 208963]} mrrvvitglgivsclgndkdtvsanlragrpgirfnpsyaemglrshvsgsvdlnleeli drkvfrfmgdaaayaylameqaikdsgltpeqisnprtgliagsggastlnqmeaidtlr ekgvkrigpyrvtrtmgstvsaclatpfqikgvnysissaaatsahcigqameqiqlgkq dvvfagggeeehwsqsclfdamgalstqynetpekasraydakrdgfviaggggmvvvee lehalkrga
Timeline for d7ppsa1: