SCOPe 2.08: Domain d7biab2: 7bia B:78-210

Lineage for d7biab2 (7bia B:78-210)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries)

8. Domain d7biab2: 7bia B:78-210 [422502]
   Other proteins in same PDB: d7biaa1, d7biab1
   automated match to d11gsa1
   complexed with gsh, mes, tvq

Details for d7biab2

PDB Entry: 7bia, 1.73 Å

PDB Description: crystal structure of human gstp1 bound to iberin

PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d7biab2:

Sequence; same for both SEQRES and ATOM records:

>d7biab2 a.45.1.1 (B:78-210) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d7biab2:

• d7biab2 is new in SCOPe 2.08-stable