Lineage for d7v30g_ (7v30 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 3086120Species Sus scrofa [TaxId:9823] [422437] (4 PDB entries)
  8. 3086180Domain d7v30g_: 7v30 G: [422497]
    Other proteins in same PDB: d7v30a1, d7v30a2, d7v30a3, d7v30e_
    automated match to d7b93u_
    complexed with 2mr, 8q1, adp, cdl, fes, fmn, mg, nai, ndp, pee, plx, sf4, uq, zn

Details for d7v30g_

PDB Entry: 7v30 (more details), 2.7 Å

PDB Description: deactive state complex i from q1-nadh dataset
PDB Compounds: (G:) acyl carrier protein, mitochondrial

SCOPe Domain Sequences for d7v30g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7v30g_ a.28.1.0 (G:) automated matches {Sus scrofa [TaxId: 9823]}
sdappltleaikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgf
eipdidaeklmcpqeivdyiadkkdvye

SCOPe Domain Coordinates for d7v30g_:

Click to download the PDB-style file with coordinates for d7v30g_.
(The format of our PDB-style files is described here.)

Timeline for d7v30g_:

  • d7v30g_ is new in SCOPe 2.08-stable