Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d7sg2j2: 7sg2 J:130-255 [422489] Other proteins in same PDB: d7sg2a1, d7sg2d1, d7sg2e1, d7sg2f1, d7sg2j1 automated match to d3of6b2 complexed with act, ca, edo, nag |
PDB Entry: 7sg2 (more details), 3.1 Å
SCOPe Domain Sequences for d7sg2j2:
Sequence, based on SEQRES records: (download)
>d7sg2j2 b.1.1.2 (J:130-255) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgra
>d7sg2j2 b.1.1.2 (J:130-255) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepsehtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplksr yalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
Timeline for d7sg2j2: