SCOPe 2.08: Domain d7sg2j2: 7sg2 J:130-255

Lineage for d7sg2j2 (7sg2 J:130-255)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d7sg2j2: 7sg2 J:130-255 [422489]
   Other proteins in same PDB: d7sg2a1, d7sg2d1, d7sg2e1, d7sg2f1, d7sg2j1
   automated match to d3of6b2
   complexed with act, ca, edo, nag

Details for d7sg2j2

PDB Entry: 7sg2, 3.1 Å

PDB Description: xpa5 tcr in complex with hla-dq2-omega1

PDB Compounds: (J:) T-cell receptor, xpa5, beta chain

SCOPe Domain Sequences for d7sg2j2:

Sequence, based on SEQRES records:

>d7sg2j2 b.1.1.2 (J:130-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

Sequence, based on observed residues (ATOM records):

>d7sg2j2 b.1.1.2 (J:130-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepsehtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplksr
yalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra

Timeline for d7sg2j2:

• d7sg2j2 is new in SCOPe 2.08-stable