Lineage for d1xdtt2 (1xdt T:1-188)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139266Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 139267Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 139268Family d.166.1.1: ADP-ribosylating toxins [56400] (8 proteins)
  6. 139277Protein Diphtheria toxin, N-terminal domain [56404] (1 species)
  7. 139278Species Corynebacterium diphtheriae [TaxId:1717] [56405] (7 PDB entries)
  8. 139287Domain d1xdtt2: 1xdt T:1-188 [42245]
    Other proteins in same PDB: d1xdtr_, d1xdtt1, d1xdtt3

Details for d1xdtt2

PDB Entry: 1xdt (more details), 2.65 Å

PDB Description: complex of diphtheria toxin and heparin-binding epidermal growth factor

SCOP Domain Sequences for d1xdtt2:

Sequence, based on SEQRES records: (download)

>d1xdtt2 d.166.1.1 (T:1-188) Diphtheria toxin, N-terminal domain {Corynebacterium diphtheriae}
gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
ymaqacag

Sequence, based on observed residues (ATOM records): (download)

>d1xdtt2 d.166.1.1 (T:1-188) Diphtheria toxin, N-terminal domain {Corynebacterium diphtheriae}
gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpnydddwkgfystdnkydaagys
vdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteefikr
fgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyeymaqac
ag

SCOP Domain Coordinates for d1xdtt2:

Click to download the PDB-style file with coordinates for d1xdtt2.
(The format of our PDB-style files is described here.)

Timeline for d1xdtt2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xdtr_