Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families) possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster |
Family d.15.13.0: automated matches [254297] (1 protein) not a true family |
Protein automated matches [254683] (5 species) not a true protein |
Species Sus scrofa [TaxId:9823] [422441] (3 PDB entries) |
Domain d7v30a2: 7v30 A:274-359 [422442] Other proteins in same PDB: d7v30a1, d7v30a3, d7v30e_, d7v30g_, d7v30x_ automated match to d6zk912 complexed with 2mr, 8q1, adp, cdl, fes, fmn, mg, nai, ndp, pee, plx, sf4, uq, zn |
PDB Entry: 7v30 (more details), 2.7 Å
SCOPe Domain Sequences for d7v30a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7v30a2 d.15.13.0 (A:274-359) automated matches {Sus scrofa [TaxId: 9823]} klfnisghvnhpctveeemsvplkeliekhaggviggwdnllavipggsstplipksvce tvlmdfdalvqaqtglgtaavivmdr
Timeline for d7v30a2: