Lineage for d7v30a2 (7v30 A:274-359)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2935190Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families) (S)
    possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster
  5. 2935198Family d.15.13.0: automated matches [254297] (1 protein)
    not a true family
  6. 2935199Protein automated matches [254683] (5 species)
    not a true protein
  7. 3086124Species Sus scrofa [TaxId:9823] [422441] (3 PDB entries)
  8. 3086125Domain d7v30a2: 7v30 A:274-359 [422442]
    Other proteins in same PDB: d7v30a1, d7v30a3, d7v30e_, d7v30g_, d7v30x_
    automated match to d6zk912
    complexed with 2mr, 8q1, adp, cdl, fes, fmn, mg, nai, ndp, pee, plx, sf4, uq, zn

Details for d7v30a2

PDB Entry: 7v30 (more details), 2.7 Å

PDB Description: deactive state complex i from q1-nadh dataset
PDB Compounds: (A:) nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

SCOPe Domain Sequences for d7v30a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7v30a2 d.15.13.0 (A:274-359) automated matches {Sus scrofa [TaxId: 9823]}
klfnisghvnhpctveeemsvplkeliekhaggviggwdnllavipggsstplipksvce
tvlmdfdalvqaqtglgtaavivmdr

SCOPe Domain Coordinates for d7v30a2:

Click to download the PDB-style file with coordinates for d7v30a2.
(The format of our PDB-style files is described here.)

Timeline for d7v30a2:

  • d7v30a2 is new in SCOPe 2.08-stable