Lineage for d7tlfo_ (7tlf O:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005102Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3005103Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 3005104Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (2 proteins)
    consists of a long beta-hairpin and a single alpha-helix
  6. 3086108Protein automated matches [422425] (1 species)
    not a true protein
  7. 3086109Species Proteomonas sulcata [TaxId:77928] [422426] (1 PDB entry)
  8. 3086110Domain d7tlfo_: 7tlf O: [422427]
    Other proteins in same PDB: d7tlfb_, d7tlfd_, d7tlff_, d7tlfh_, d7tlfj_, d7tlfl_, d7tlfn_, d7tlfp_
    automated match to d1xg0b_
    complexed with dbv, peb

Details for d7tlfo_

PDB Entry: 7tlf (more details), 2.8 Å

PDB Description: structure of the photoacclimated light harvesting complex pe545 from proteomonas sulcata
PDB Compounds: (O:) Phycoerythrin alpha-subunit 2

SCOPe Domain Sequences for d7tlfo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7tlfo_ d.184.1.1 (O:) automated matches {Proteomonas sulcata [TaxId: 77928]}
amdksakapvitifdhrgcsrapkeytgskasgqddemmvkaqsvkiavsdgvaesvlkd
slsvmhk

SCOPe Domain Coordinates for d7tlfo_:

Click to download the PDB-style file with coordinates for d7tlfo_.
(The format of our PDB-style files is described here.)

Timeline for d7tlfo_:

  • d7tlfo_ is new in SCOPe 2.08-stable