Lineage for d7t7qx_ (7t7q X:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903517Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)
  7. 2903719Species Staphylococcus aureus [TaxId:1280] [188976] (33 PDB entries)
  8. 3086103Domain d7t7qx_: 7t7q X: [422420]
    automated match to d3sqyx_
    complexed with 06u, act, ndw

Details for d7t7qx_

PDB Entry: 7t7q (more details), 2.2 Å

PDB Description: r-27 in complex with s. aureus dhfr and alpha-nadph - remediated for comparison with tnadph
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d7t7qx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7t7qx_ c.71.1.1 (X:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d7t7qx_:

Click to download the PDB-style file with coordinates for d7t7qx_.
(The format of our PDB-style files is described here.)

Timeline for d7t7qx_:

  • d7t7qx_ is new in SCOPe 2.08-stable