Lineage for d7rrla2 (7rrl A:156-327)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999256Protein automated matches [226882] (10 species)
    not a true protein
  7. 2999283Species Human (Homo sapiens) [TaxId:9606] [225057] (9 PDB entries)
  8. 3086100Domain d7rrla2: 7rrl A:156-327 [422417]
    Other proteins in same PDB: d7rrla1, d7rrlb1
    automated match to d5mdha2

Details for d7rrla2

PDB Entry: 7rrl (more details), 2.05 Å

PDB Description: alternate crystal form of human malate dehydrogenase i
PDB Compounds: (A:) Malate dehydrogenase, cytoplasmic

SCOPe Domain Sequences for d7rrla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7rrla2 d.162.1.1 (A:156-327) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trldhnrakaqialklgvtandvknviiwgnhsstqypdvnhakvklqgkevgvyealkd
dswlkgefvttvqqrgaavikarklssamsaakaicdhvrdiwfgtpegefvsmgvisdg
nsygvpddllysfpvviknktwkfveglpindfsrekmdltakelteekesa

SCOPe Domain Coordinates for d7rrla2:

Click to download the PDB-style file with coordinates for d7rrla2.
(The format of our PDB-style files is described here.)

Timeline for d7rrla2:

  • d7rrla2 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7rrla1