Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (21 species) not a true protein |
Species Sparus aurata [TaxId:8175] [422303] (1 PDB entry) |
Domain d7e4ug_: 7e4u G: [422403] automated match to d2z9sa_ complexed with ca, gol |
PDB Entry: 7e4u (more details), 2.6 Å
SCOPe Domain Sequences for d7e4ug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7e4ug_ c.47.1.10 (G:) automated matches {Sparus aurata [TaxId: 8175]} agnaqigklapdftakavmpdgqfkdlkmsdyrgkyvvfffypldftfvcpteiiafsda addfkkigceviaasvdshfshlawintprkqgglgtmkiplvsdtrrtistdygvlked dgiayrglfiiddkgilrqitindlpvgrsveetlrlvqafqftdkhgevc
Timeline for d7e4ug_: