Lineage for d7ojza2 (7ojz A:209-315)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2960042Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2960043Protein automated matches [226843] (9 species)
    not a true protein
  7. 2960066Species Staphylococcus aureus [TaxId:1280] [327472] (14 PDB entries)
  8. 3086066Domain d7ojza2: 7ojz A:209-315 [422383]
    Other proteins in same PDB: d7ojza1, d7ojza3
    automated match to d4m8ia2
    complexed with edo, gp2, k

Details for d7ojza2

PDB Entry: 7ojz (more details), 1.65 Å

PDB Description: saftsz complexed with gmpcp
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d7ojza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ojza2 d.79.2.0 (A:209-315) automated matches {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d7ojza2:

Click to download the PDB-style file with coordinates for d7ojza2.
(The format of our PDB-style files is described here.)

Timeline for d7ojza2:

  • d7ojza2 is new in SCOPe 2.08-stable