Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (14 species) not a true protein |
Species Camelus dromedarius [TaxId:9838] [422349] (1 PDB entry) |
Domain d7opzc2: 7opz C:85-217 [422350] Other proteins in same PDB: d7opza1, d7opzb1, d7opzc1, d7opzd1 automated match to d6gswa1 complexed with gsh, na |
PDB Entry: 7opz (more details), 2.55 Å
SCOPe Domain Sequences for d7opzc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7opzc2 a.45.1.1 (C:85-217) automated matches {Camelus dromedarius [TaxId: 9838]} lcgeteeekirvdvlenqamdtrldfarvcynpdfeklkpgflkeipekmklfseflgkr twfagdklnyvdflaydvldvyrifepkcldefpnlkdfmsrfeglkkisaymkssrflr splflkmamwgnk
Timeline for d7opzc2: