Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Camelus dromedarius [TaxId:9838] [422347] (1 PDB entry) |
Domain d7opzc1: 7opz C:1-84 [422348] Other proteins in same PDB: d7opza2, d7opzb2, d7opzc2, d7opzd2 automated match to d6gsta2 complexed with gsh, na |
PDB Entry: 7opz (more details), 2.55 Å
SCOPe Domain Sequences for d7opzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7opzc1 c.47.1.0 (C:1-84) automated matches {Camelus dromedarius [TaxId: 9838]} pmilgywdirglahairllleytgsdyeekiysmgdapdydrsqwlsekfklgldfpnlp ylidgahrltqsnailryiarkhn
Timeline for d7opzc1: